← All Stories

The Art of Floating

spyswimmingspinachpadelvitamin

The chlorinated water of the pool at 6 AM was the only place Elena could still breathe. Her husband Mateo had grown distant in that particular way that screams *something* without ever saying a word—the way he checked his phone during dinner, the locked screen that faced away from her, the sudden interest in after-work *padel* matches with colleagues she'd never met.

She emerged from the water, goggles marking her face like forensic evidence, and found him in the kitchen. He was making a smoothie with *spinach*, protein powder, and some new *vitamin* supplement his trainer had recommended—the same trainer who'd also suggested the padel lessons.

"You're *swimming* later than usual," he said, not turning around.

"Pool heater was broken."

"Right."

The silence between them had grown textured, layered with unsaid things. Elena had started *spy*-ing on him three weeks ago—checking his location when he was late, scrolling through his Spotify activity, noting which padel courts he frequented. She hated herself for it, this digital unraveling of her dignity, but the not-knowing was worse.

"There's a corporate tournament this weekend," Mateo said finally, still facing away. "At the club. Mixed doubles."

Elena felt something crack inside her. "Mixed doubles."

"Yeah. They need partners."

"And who's your partner?"

He turned then, and she saw it—that slight hesitation, the micro-expression she'd become an expert in reading during fourteen years of marriage.

"Sophia. From accounting."

The name hung there. Elena had seen Sophia in the company photos—twenty-six, radiant, the kind of woman who still believed in spontaneous joy rather than carefully constructed stability.

"Sounds nice," Elena said, and her voice didn't waver. "I think I'll start that new vitamin regimen this weekend. The one you showed me."

"Really? That's—great, Elena. That's really good."

She watched him leave, gym bag in hand, and wondered if swimming had taught her to hold her breath so long she'd forgotten how to gasp. The art of floating wasn't about staying above water at all—it was about learning to exist while slowly drowning.

Elena opened the cabinet where she kept her vitamins. Her hand hovered over Mateo's bottle, then moved to her own—simple, unadorned, honest. She swallowed two without water, dry and bitter, and thought about how she used to crave certainty. Now she'd settle for the courage to finally exhale.